GenomeNet

>eca:ECA4165 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glpA; anaerobic glycerol-3-phosphate dehydrogenase subunit A (A)
MKQNTGNWRETDVVVIGGGATGAGTARDCALRGLRCLLLERYDIATGATGRNHGLLHSGA
RYAVTDGESARECIEENQILRRIARHCIEPTDGLFITLPEDDLGWQAQFITACQQAGIGA
QALDPQEALRLEPAANPTLIGAVRVPDGSVDPFRLTAANMIDACEHGAEVLTYHEVIGLI
RQGDRITGVRVFDHKKGVETEIYAQVVVNAGGIWGQHIAEYADLRVRMFPAKGALLILGH
RINNMVINRCRKPADADILVPGDTISLIGTTSTHIDYDQIDNMLVTPAEVETLMREGSML
APALASTRILRAYAGVRPLVANDSDPSGRSVSRGIVLLDHASRDGLEGFITITGGKLMTY
RLMAEWVTDAICKKLGHDVACSTAQTPLPGSESLDEVKTVPHALSAYPAAKPLSAPLRGS
AIYRHGERAGRMLSGERLDRSLVCECEAVTAGEVRYAVESLQVNNLIDLRRRTRVGMGTC
QGELCACRAAGLLCRLGTATPEQSLTQLSQFLNERWKGIRPVAWGNALRESEFTSWIYQG
LCGLTASDSQEDRHAL

BLAST