GenomeNet

>ecas:ECBG_00844 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MNNKVILQGFEWDLPADSQHWNKLKEMSKEIKEYGFTAIWLPPAYKGTAGSEDVGYGVYD
YYDLGEFDQKGSVPTKYGTKDEYLEAIKALQEQGIEVYADIVFNHLIGADEKEVVPAVKY
NTENRNEPISDEEEIEAWTKFTFPGRQGTYNDYVWTWHNFSGVDYDDRNKDHGIFNFADK
GWENQVDDEMGNYDYLMGCDLDMENPETVEQLNKWGQWYQELTGVDGYRLDAVKHIEFNY
YADWILNRREEKGKPLFVVGEYWSGDLPKLEEYLDSSGNLIYLFDVPLHYNLYEASHSNG
EYDMSQIFAGTLTAAREDYAVTFVDNHDTQVGQSLQSWIDGWFKVHAYSLILLRKAGVPV
VFWGDLFGIPAQEIAPVGDALVHMLKLREKLAFGNQVDYFDDPNCIGWVLTGDYEHELSG
LAVVMTNAQGAEKEMTISAIHGGETFVDILRNNEAKVVLDDTGKGVFPVNDGQVSIYVNE
KLVEKYFS

BLAST