GenomeNet

>ecb:100034244 SDHA; succinate dehydrogenase complex, subunit A, flavoprotein (Fp); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLESEGTELRNCRRASGRTVLTPSAKEARLRGTRPRTHVILTEQHARQKLTERREARSRH
PATAGCPAQRGAASRHPDSAQSPGPETYRRPLLPRTPTSSPPQARPGAGLVGLPAEGKHV
GVCALSRLLPARRLALTRAQWPATLQTRGFHFTVDGTKRASAKVSDSISTQYPVVDHEFD
AVVVGAGGAGLRAAFGLSEAGFDTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHF
YDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGS
IHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGA
GCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDH
VYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLK
HVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCKPGDKVPP
IKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKISQLY
GDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDE
YDYSKPIQGQQKKPFEEHWRKHTLSYVDVKTGKVSLEYRPVIDRTLNEADCATVPPAIRS
Y

BLAST