GenomeNet

>ecb:100052401 K11405 histone deacetylase 8 [EC:3.5.1.98] | (RefSeq) HDAC8; histone deacetylase 8 isoform X1 (A)
MLTREHRCGRSEEQEPELGLSPKKAGSGRWLRHGWKWKMEEPEEPADSGQSLPPVYIYSP
EYVSICDSLAKVPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKV
SQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAVGGATITAAQCLIDGMCKVAINWSGGWH
HAKKDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHK
FSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKEVYIAFNPKAVVL
QLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVI
LGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRVQQILNYIKGNLKHVV

BLAST