GenomeNet

>ecb:100053438 K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] | (RefSeq) KMT5B; histone-lysine N-methyltransferase KMT5B isoform X1 (A)
MKWLGEAKNMVVNGRRNGGKLSNDHQQTQPKVQHTGKDTVKAGRTAGERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKTQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSTRKSSIGVKKNSKGRGLTRPPASARST
SSTLTHASSSRAPKTLRKPAKPLPSKTKLRNHCKRLEQKSASRKLEMGNLVLKEPKVVLY
KNLPIKKDKEPEGPVQANVAGGCLTRHAAREHKQNSGRGAPSHGEGAPCTYTPRRSMRTR
TNLKETSDIKLEPNTLDGYKDSSTEPCPDSGEQPTPTVQEEELAHETAQNGEAKCHKTDN
SMSKKKSRQGKLVKQSAKPEESTPVHDSPGKAGVALDVMGSHSDQDEHSGPEGLPGSYTD
WAPSPGGGSVVTSDSFKAKDNFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRRHDSS
SKANDQESDGMNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLKRDEEG
RGSYVEGLHENGVCCSDPLSLLESQMEVGDYSQYEEESTDGPSSSEGDEEDDDDDDFEDD
FIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA

BLAST