GenomeNet

>ecb:100056120 K18494 histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43] | (RefSeq) SETDB2; PHD finger protein 11 isoform X5 (A)
MEKRNCALCPKDLECSVMYFARSENIAAHENCLLYSSALVECEDHDSHNADRNFDVKSVK
KEIKRGSKLRCKFCGKKGATVGCEVQACLKNYHFFCAKNDNAVLQTDGSQGIYKLFCQVH
APLINTQNADFSGVKRKRGRKRRLPEGIYIQPSEAETFTRLIKQMNEDGRQTDATVKVDF
LKKCKEAGLLDDFFEEILDKLHLIQERLMDETTSESEYKEIGTSLLDCRLFEDAFMSFQT
EIENKIHQSEERRQQLKEEIELLQDLKQSLSSLQENRSSSTSLSSLSP

BLAST