GenomeNet

>ecb:100057692 K11425 histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43] | (RefSeq) NSD3, WHSC1L1; nuclear receptor binding SET domain protein 3 (A)
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIVEDGGQTPYEATLQQGFQYP
PTTEDLPPLTNGYPPSISMYETQTKYQSYNQYPNGSANGFGAVRNFSPADYYHSDIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
DLVLKEETPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKNVASKAEVKKTR
RPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHMSVEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRNEKATQNISSPETTSGSTGSAEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGSADRGVQGSVRFSDSSVSAAIEETVDVGFGKQVDSPSATAE
ADVSDVQSVDSSLSRRGIGMSKKDAVCQVCESSGDSLIPCEGECCKHFHLECLGLASLPD
GKFVCMECKTGQHPCFSCKMSGTDVKRCSVGACGKFYHEACVRKFPTAIFESKGFRCPQH
CCSACSMEKDVHKASKGRMMRCLRCPVAYHTGDACIAAGSMSVSSCIFICSNHSKRSSNS
SSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKK
CEKGGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRWWPA
EICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKT
FKKALEEAAKRFQELKAQRESKEALEIEKSSRKPPPYKHIKANKVIGKVQIQVADLSEIP
RCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKRLYPDAEIIKTERRG
WGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKG
NYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTFNYNLDCLGNGRTECHCG
ADNCSGFLGVRAKSACASTTEEKAKNAKLKQKRRKIKTEPKQMHEDYCFQCGDGGELVMC
DKKDCPKAYHLLCLNLTQPPYGKWECPWHQCNECSSAAVSFCEFCPRSFCKDHEKGLLVP
SALEGRLCCSEHDPVSPVSSEYWSKIKCKLESQDPGEEVKE

BLAST