GenomeNet

>ecb:100064801 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) ACE; angiotensin-converting enzyme isoform X2 (A)
MGAASGRRGPEPPPPPLPPLLLLLPLLLPPPPPTLALDPALQPGNFTADEAGAQLFAQSF
NSSAEQVLFQSSAASWAYVTNITQENARRQEDAALLNQEFAEVWGQKCKELYDPIWQNFT
DPILRRVISGVRILGPANLPLKKRQQYNSLLSNMNRIYSTAKVCYPNKTATCWSLDPELT
NILAVSRSYALLLYAWEGWHNTVGIPLKPLYQDFTALSNEAYKLDGFSDTGAYWRSWYES
PTFMEDLEHLYHQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWDNI
YDMVVPFPDKPNLDVTSAMVQKGWNATHMFWVAEEFFTSLGLLPMPPEFWAESMLEKPSD
GREVVCHASAWDFYNRKDFRIKQCTRVTLEQLSTVHHEMGHVQYYLQYKDQPVSLRQGAN
PGFHEAIGDVLALSVSTPTHLYKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQ
WRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVLRNETHFDAGAKFHVPNVTPYIRYFVS
FILQFQFHQALCKEAGHQGPLHQCDIYQSTQAGAKLRELLQAGSSRPWQEVLKDMIGSDA
LDAQPLLNYFQPVSQWLQEQNQQNDEVLGWPEYQWYPPMPDNYPESIELVSDEAEASKFV
EEYDRRSQVVWNEYAEANWNYNVNITTEASKILLQQNIQMANHTVKYGTWARQFDVTNFQ
NTTMKRMIKKIQDLERAALPVKELQEYNKILLDMETTYSVASVCLANGTCLQLEPDLTNL
MATSRKYEELLWAWQGWRDNVGRSILPFFPKYVELFNKAARLNGYVDAGDSWRSMYEMPS
LEQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHVNLEGPIPAHLLGNMWAQTWSNIYD
LVVPFPSAPKMDATEAMIKQGWTPRRMFEEADNFFTSLGLLPVPPEFWNKSMLEKPTDGR
EVVCHASAWDFYNGKDFRIKQCTAVNMEDLVVAHHEIGHIQYFMQYKDLPVTFREGANPG
FHEAIGDVLALSVSTPKHLYNINLLSSEGGGYEQDINFLMKMALDKIAFIPFSYLVDQWR
WRVFDKSITKENYNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYIRYFVSFV
IQFQFHEALCQAAGHKGPLHKCDIYQSKEAGKRLADAMKLGFSKPWPEAMKLITGQPNMS
ASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPNSARSEASFLGTGRVNFLGLNLEEQ
QARVGQWMLLFLGVALLVATLGLTQRLFSIRQYSLRQPHRGPQFCSEVELRRS

BLAST