GenomeNet

>ecb:100065312 TK2; thymidine kinase 2, mitochondrial; K00857 thymidine kinase [EC:2.7.1.21] (A)
MEPVAKWRNVRGHNPLGLMYRDACRWGLTLQTYVQLTMLNQHTRPQTSPVRLMERSIHSA
RYIFVENLYRSGKMPEVDYVVLSEWFDWIVRNIDVSVDLIVYLRTTPETCYQRLKMRCRE
EEKVIPLEYLDAIHHLYEEWLIKGGLFPVTAPVLVIEADHNMQKMLELFEHNRDRILTPE
NWKHGP

BLAST