GenomeNet

>eck:EC55989_1333 tdk; thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALQVGSLTAIQERHRHD

BLAST