GenomeNet

>eco:b1238 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tdk; thymidine kinase/deoxyuridine kinase (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALQVDSLTAIQERHRHD

BLAST