GenomeNet

>ecr:ECIAI1_2137 wzb; tyrosine phosphatase (EC:3.1.3.48); K01104 protein-tyrosine phosphatase [EC:3.1.3.48] (A)
MFNNILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSL
EGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKS
RETFAAVYTLLERSARQWAQALNAEQV

BLAST