GenomeNet

>ecr:ECIAI1_2137 K01104 protein-tyrosine phosphatase [EC:3.1.3.48] | (GenBank) wzb; protein-tyrosine phosphatase (A)
MFNNILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSL
EGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKS
RETFAAVYTLLERSARQWAQALNAEQV

BLAST