GenomeNet

>eec:EcWSU1_02589 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; Thymidine kinase (A)
MIRVLRPMAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRI
GLSSPARLFNPQTDLLEDIRTAHASQPIHCVLVDESQFLTREQVHALSEVVDELDIPVLC
YGLRTDFRGELFAGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGKPYADGEQVVIG
GNERYVSVCRKHYKEALIVGSLTALQPDNRK

BLAST