GenomeNet

>eel:EUBELI_01767 type II restriction enzyme; K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MTNRNFDEWLSKFRPSISSYDYYIDFAKVVRNVDEIKVELNILNSLIASKNIEEEFEKIV
TKYPETLQCVPLLLAVRGHEIYAQDEEGAFLYNFKKMNYSVEQYKVFMRKTGLFDMIANH
LVNNLVDYALGIETGLDSNGRKNRGGHQMEDLVEKYIVAAGFKKNENYFKEMYLKDIESK
WNIDLSALSNQGKAAKRFDFVIKTDKMIYGIETNFYGGGGSKLNETARSYKMLAQEADTI
EGFTFVWFTDGIGWKSARGNLRETFEVMDTIYSINDMENGVMQKLFE

BLAST