GenomeNet

>efa:EF2555 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tdK; thymidine kinase (A)
MAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVLMTSGLDTRDGVGKVSSRIGLRRDAI
PIFEETNVFDLINDLSYKPFCVLVDECQFLNKHHVIEFARIVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLYADKLEELKTICWFCHKKATMNLHYIDGNPVYEGDQVQIGGNEAYYPVC
RKHYFHPKTVNEEQ

BLAST