GenomeNet

>efd:EFD32_0766 aldose 1-epimerase family protein (EC:5.1.3.3); K01785 aldose 1-epimerase [EC:5.1.3.3] (A)
MKDNRITVTDIPNTNLKKITLKNDFLEVALLNYGARLHQLLMPNKNNHWENILLSYDSYQ
DVLKDQSFFGATVGPVAGRIRNGHWQNGILEQNSDGHHIHGGSKGWSFQYWTVEPFEKKD
IIGVAFHLTDTISGYPGPIEATITYQLEDNHLRMISTGRSKQETLFNPTNHAYFNLSGDG
KLDILSHLLSLNCQGMLELDDNKLPTGRILPASELSIRFNELTPIETILQRYPTGLDDVF
PLVGSDLRQPQLCLQEPTSGRKMTIATTNQSMVLFSTTGFEAPFSINGQAMHSNYGLAIE
PQEYPDIVHHPQWGSILLPANKKQTYQTVYQFNLL

BLAST