GenomeNet

>efd:EFD32_2124 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVLMTSGLDTRDGVGKVSSRIGLRRDAI
PIFEETNVFDLINDLSYKPFCVLVDECQFLNKHHVIEFARIVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLYADKLEELKTICWFCHKKATMNLHYIDGKPVYEGDQVQIGGNEAYYPVC
RKHYFHPKTVNEEQ

BLAST