GenomeNet

>efe:EFER_0924 glpB; anaerobic glycerol-3-phosphate dehydrogenase subunit B; K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] (A)
MRFDTVIMGGGLAGLLCGLQLQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQAVTDI
HSGLESLRQQAPAHPYSLLGPQRVLDLACQAQTLIAESGAQLQGSVEQAHQRITPLGTLR
STWLSSPEVPVWPLPAKKICVVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLR
NNATEFRAVNIARFLDNEENWSLLLDALIPVANTCEMILMPACFGLADDKLWYWLNEKLP
CSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVKKVTCKNGMVNEIWTRNHADI
PLRPRFAVLASGSFFSGGLVAEREGIREPIVGLDVLQTATRGEWYKGDFFAPQPWQQFGV
TTDEALRPSQAGKTIENLFAIGSVLGGFDPIAQGCGGGVCAVSALHAAQQIAQRAGGQQ

BLAST