GenomeNet

>efe:EFER_0924 K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] | (GenBank) glpB; sn-glycerol-3-phosphate dehydrogenase (anaerobic), membrane anchor subunit (A)
MRFDTVIMGGGLAGLLCGLQLQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQAVTDI
HSGLESLRQQAPAHPYSLLGPQRVLDLACQAQTLIAESGAQLQGSVEQAHQRITPLGTLR
STWLSSPEVPVWPLPAKKICVVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLR
NNATEFRAVNIARFLDNEENWSLLLDALIPVANTCEMILMPACFGLADDKLWYWLNEKLP
CSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVKKVTCKNGMVNEIWTRNHADI
PLRPRFAVLASGSFFSGGLVAEREGIREPIVGLDVLQTATRGEWYKGDFFAPQPWQQFGV
TTDEALRPSQAGKTIENLFAIGSVLGGFDPIAQGCGGGVCAVSALHAAQQIAQRAGGQQ

BLAST