GenomeNet

>efi:OG1RF_12076 K12111 evolved beta-galactosidase subunit alpha [EC:3.2.1.23] | (GenBank) ebgA; cryptic beta-D-galactosidase subunit alpha (A)
MKTWENYKVDSINRLPGRAHFSSFPSKETALLNENKYTQAYKNLNGCWHFLFLEAPEYSP
ENFFATDFDTSQMDQITVPGNWQVQGYGKMHYSDLWYNFPINPPYVPTENPTGIYKRTFA
IDETFHDKKIILRFCGVDSAYHVWVNGHEVGYSKGARNEAEFDITPYAKIGETNDLTVRV
YQWSDGTYLEDQDMWWLSGIFRDVELLGVPENGLEDFFIISDLDDSYQNGHLAITGKFWQ
DKGQQVQLELMDQQGKTVLKETVAGNQGTVEFSASLPSVTAWSAEKPYLYQLFITVFSEG
EVVEVIPQKVGFRNIHVSGETFLVNGVAIKLKGMNRHDYNPKNGRVVSREEIEKDIRLMK
QFNINAIRTSHYPASAYFYDLCDEYGMYVIDETDLECHGFELTGEYDWISNNPEWETAYV
SRMVRMIQRDKNHPSILFWSLGNESAFGHNFIEMARIAKEMDPTRLVHYEGDFEAEVTDV
YSTMYTWLEHPTRELLMNTIIENSKKPHILCEYCHAMGNGPGNLKEYQELFYAHDKLQGG
FIWEWFDHGIESVTDNGEVYYRYGGDFGDDPSNKDFCIDGMLMPDRTPSPSLYEYKKVIE
PITTSAIDVLSGEFSLLSRFDFENLAIFKLVYTITEDQTVIQSGTVAVPAIAAREEGRLH
LPYHLDFPKKAGAAYYLTLSYQLKETTAYASAGHELATAQFELPITTPGIEITPVGLLMA
KEIGPHLYIEGPNFSINFDKVKGALTNVTRDGKKLLHKGPKFTFWRAPISNDMEIIDEMK
KKYFLHLEHEIVRSFEWKKVDDFIQVIVKTINGTTNSAWHYQCTYQYLIAPNGEIFFDLK
GSPAGKIENAPDMLPRLGVTLHLDKSLSEVKYFGKGPRENYVDSQEAGLLGVYEATVAEM
FTNYVVPQANGNHMATKWSAFTDDRGQGVVATAADSYNFSVSYFEEQTLDVAKHTNELQE
SEYVVLNIDYKQNALGSYSCGQWQLEKYRTTFEEFQLAFRLTPFNNKEIQAADVAHERVK
RPTIS

BLAST