GenomeNet

>ehr:EHR_05965 glycosyl hydrolase family protein; K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] (A)
MIMWGGATAASQYEGGFDKKKGIDTQDCRPYLPRNSNATMQTRLLTKQVIQESKDEESKL
YYPFRVGTKGYEYVEEDLNLLKELGIQIYRFSLSWARLFPKGIEEKPDMEGVQYYDQIFE
FCKQNNIKIFLTMNHYAVPLYLVENYGGWTNRNMIRYYLNFANFVFERWGSYVDYWLPFN
EINAGYFSPYNGTGLIKPESEGYDMQKVFESLHHQFVANAKTIQLAKKLKVSGEFGAMIS
CFCYYPFTPKPEDNFKLVKEEQVNQWFCSDVLMKGKYPYYMDDFFEKNKVNLNITKDDKK
VLSEFPCEFISFSYYSSSVVTTEEVEKTAGNLVITTKNPYLQASEWGWQIDAIGLRTTLN
KVYDRYNCPVIIAENGFGAKDVLEKEQVHDLYRINYFDSHFNEIIKAEKEDKVDIRAYIA
WGIIDIVSAGSCEMDKRYGVIYVDGDNEGNGTYRRYKKDSFYWYQDFIKKQTNKI

BLAST