GenomeNet

>ehx:EMIHUDRAFT_61679 hypothetical protein; K01805 xylose isomerase [EC:5.3.1.5] (A)
HRSDVRPEGATQAESDANFDIIAERLGEVQAASGLKLLWGTANLFTPRRYMNGAATNPDP
AVFARAAASVKKCLEVTHRLGGENYVLWGGREGYQSILNTNVRLELDNLARFLSMVAEHK
HKVGFRGPLLLEPKPREPMAHQYDYDAATVLGFLRQYGLQDEFALNLEANHGTLAGHTGE
HETAMAAAFGKLGSIDANRNEAAMLGWDTDMFPNDVGLATYIMDVVLKQGGLAPGGLNFD
AKVRRESTDVEDLFIGHINGMDTYARGLRNAARMQAEGTMGALVDERYAGYERTALGRQI
VGGRTSLEELAALVADEPEPQQRSAKVELYESIFLATMQE

BLAST