GenomeNet

>eic:NT01EI_2127 alpha amylase family protein, catalytic domain protein (EC:3.2.1.1); K01176 alpha-amylase [EC:3.2.1.1] (A)
MKYAILAALLLPVAAGADWRSPVFPRFAAVGEGVFSASQALAKGEAPLQLYQADRCWQPS
GTIRLNQTLSLMPCQGEAPRWRRFRDGRYQARVDTRPGTPTLMLSVQDEAVQRAAAPVRP
CPRWNGRPLRVPVDQAFSEGSRVRDFYSGEVARVTQGTVTLQPAPGSNGLLLLESAETAG
PAAFDWHNATVYFVLVDRFANGDPSNDNSYGRQQDGMQEIGTFHGGDLRGLTGKLDYLQR
LGVNVLWISSPLEQIHGWVGGGSRGDFPHYAYHGYYPLDWTRLDANMGSEQDLRALVEGA
HRRGIRVLFDVVMNHTGYATLADMQQYRFGALFLQGETLRQTLGTHWSDWRPGRGQTWHS
FNDYIDFGNRTAWARWWGKGWIRTDIGDYDAPGFDDFTLSLSFLPDVKTESSVASGLPRF
YRHKPDTRAREIPGYTPRDYLTRWLSQWVREYGIDGFRIDTAKHVELAAWQQLKQQASAA
LAEWKRANPQQALDAAPFWMTGEAWGHGVMRSAYYRHGFDAMINFDYQEQAERAQACLAD
IDPLWQQMAAQLQDFNVLSYLSSHDTHLFRSGGSRAAELLLLAPGAVQIFYGDESGRPLG
PTGSDPLQGTRSDMNWQDIHGPAAAQVAHWQRLGQFRARHPAIGKGEQTTIAMPQGYGFI
RNDGRDRVMVIWAGQQE

BLAST