GenomeNet

>eic:NT01EI_2127 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) alpha amylase family protein, catalytic domain protein (A)
MKYAILAALLLPVAAGADWRSPVFPRFAAVGEGVFSASQALAKGEAPLQLYQADRCWQPS
GTIRLNQTLSLMPCQGEAPRWRRFRDGRYQARVDTRPGTPTLMLSVQDEAVQRAAAPVRP
CPRWNGRPLRVPVDQAFSEGSRVRDFYSGEVARVTQGTVTLQPAPGSNGLLLLESAETAG
PAAFDWHNATVYFVLVDRFANGDPSNDNSYGRQQDGMQEIGTFHGGDLRGLTGKLDYLQR
LGVNVLWISSPLEQIHGWVGGGSRGDFPHYAYHGYYPLDWTRLDANMGSEQDLRALVEGA
HRRGIRVLFDVVMNHTGYATLADMQQYRFGALFLQGETLRQTLGTHWSDWRPGRGQTWHS
FNDYIDFGNRTAWARWWGKGWIRTDIGDYDAPGFDDFTLSLSFLPDVKTESSVASGLPRF
YRHKPDTRAREIPGYTPRDYLTRWLSQWVREYGIDGFRIDTAKHVELAAWQQLKQQASAA
LAEWKRANPQQALDAAPFWMTGEAWGHGVMRSAYYRHGFDAMINFDYQEQAERAQACLAD
IDPLWQQMAAQLQDFNVLSYLSSHDTHLFRSGGSRAAELLLLAPGAVQIFYGDESGRPLG
PTGSDPLQGTRSDMNWQDIHGPAAAQVAHWQRLGQFRARHPAIGKGEQTTIAMPQGYGFI
RNDGRDRVMVIWAGQQE

BLAST