GenomeNet

>eih:ECOK1_2477 glpC; anaerobic glycerol-3-phosphate dehydrogenase subunit C; K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] (A)
MNDTSFENCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCK
RCEVACPSDVKIGDIIQRARAKYDTTRPSLRNFVLSHTDLMGSVSTPFAPIVNTATSLKP
VRQLLDAALKIDHRRTLPKYSFGTFRRWYRSVAAQQAQYKDQVAFFHGCFVNYNHPQLGK
DLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAITNVESIREAVGVKGIPVIAT
SSTCTFALRDEYPEVLNVDNKGLRDHIELATRWLWRKLDEGKTLPLKPLPLKVVYHTPCH
MEKMGWTLYTLELLRKIPGLELTVLDSQCCGIAGTYGFKKENYPTSQAIGAPLFRQIEES
GADLVVTDCETCKWQIEMSTSLRCEHPITLLAQALA

BLAST