GenomeNet

>eko:EKO11_4448 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) Manganese/iron superoxide dismutase-like protein (A)
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK

BLAST