GenomeNet

>elm:ELI_1752 hypothetical protein; K03738 aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5] (A)
MNGWMGQLIRVDLEAGTIKKEPLNMQAAHDFIGARGLGTKYFCDEVDPQVDPLGPDNKMI
FMTGPLTGTAASCSGRYEVVAKAPLTGTIGASNSGGHFGPELKFAGYDGIIFENQSDRPV
YLYINDDTVELRDASDLWGKDVYETTEALEEACGEGARVACIGPTGEQGCLYSAIMNDKH
RAAGRGGMGAVMGSKKLKAVVVRGSGGVTVARPEGFMAAMTDARTKLKEHPVTGGGLPTY
GTEVLVNMINEVGGLPLRNWRDGGVYDKADDTSGEALVDSYLVKNKGCFGCSIGCGRVTR
IPDGPFKSMGEGPEYEAGWSYGADCGVNDLAAICKANFLCNQYGMDPITLGSTIACAMEL
YEKGLLSEEEIGRPLPFGDAQAMVDLTELTGKMEGFGVELAQGSYRLAEKHGAPELSMSV
KKQEMPAYDGRAVQGMALEYATSNRGGCHVRGYLTSPEVLGIPLKTDPLVTEGKAPLLKT
FQDLTAAVDSSGICLFTTFGIGLPEIAAQYREAVGSDETDEEFLLKGERIWNIEKQFNIA
AGVEKDTLPPRLLREALPEGPAKGKVAELDVMLKEYYEVRGWSTEGVPTEEKVQELGL

BLAST