GenomeNet

>elp:P12B_c2336 glpC; sn-glycerol-3-phosphate dehydrogenase (Anaerobic), K-small subunit; K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] (A)
MNDTSFENCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCK
RCEVACPSDVKIGDIIQRARAKYDTTRPSLRNFVLSHTDLMGSVSTPFAPIVNTATSLKP
VRQLLDAALKIDHRRTLPKYSFGTFRRWYRSVAAQQAQYKDQVAFFHGCFVNYNHPQLGK
DLIKVLNAMGTGVQLLSKEKMLRRTANRQRLYR

BLAST