GenomeNet

>enc:ECL_01634 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LFNPQTDLLQDIRAEHTSQPIHCVLVDESQFLTREQVHALSEVVDELDIPVLCYGLRTDF
RGELFAGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQSGKPYADGEQVVIGGNERYVS
VCRKHYKEALSVGSLTAIQHDNRK

BLAST