GenomeNet

>ent:Ent638_0150 alpha amylase, catalytic region; K01176 alpha-amylase [EC:3.2.1.1] (A)
MKRSALALLLLPAMANAGWSSPGFSAFNAEGTGLFTGHATLAKGTRPLTLSFDNACWQPT
EAIKLNEMLSLKPCEGTPPQWRLFREGEYQMRIDTRSGTPTLMITVQSVTDKPVTNVTQQ
CPKWDGKPLTLDVTNTFPEGSVVRDFYSKQTAMVQQGKITLQPAANSNGLLLLERAETEK
TAPFSWQNATVYFVLTDRYVNGDPSNDNSYGRQKDDMQEIGTFHGGDLKGLTSKLDYLQN
LGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYTQDWTRLDANMGQEDDLRHLVDEA
HKRGIRILFDVVMNHTGYATLADMQEYQFGALYVQGDELKKTLGERWTDWKPAAGQSWHS
FNDYINFSDKAGWENWWGKKWIRTDIGDYDNPGFDDLTMSLAFLPDLKTESTAPSGLPNF
YRHKPDTHAKAIAGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVEMAGWQQLKEQASAA
LKAWKTAHPDQKLDDAPFWMTGESWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAD
MDLTWQQMAEKLQGYNVLSYLSSHDTRLFREGGQRAAELLLLAPGAVQIYYGDESERPFG
PTGSDPLQGTRSDMNWQEVSGSQAQTVAHWQILGQFRARHPSIGEGTQTTLSLKQGYGFT
RQHQTDKVMVVWAGNQ

BLAST