GenomeNet

>eoc:CE10_1416 tdk; thymidine kinase/deoxyuridine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MRTVVYTAEIDDRFGAGKVSSRIGLSSPAKLFNQNSSLFDEIRAEHEQQAIHCVLVDECQ
FLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVELKTICFCGRK
ASMVLRLDQAGRPYNEGEQVVIGGNERYVSVCRKHYKEALEVGSLTAIQERHRHD

BLAST