GenomeNet

>eoc:CE10_3946 glpD; sn-glycerol-3-phosphate dehydrogenase, aerobic, FAD/NAD(P)-binding protein; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRISLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNTHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQSIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQKLSLAS

BLAST