GenomeNet

>eok:G2583_2827 yfbQ; hypothetical protein; K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] (A)
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRIAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL

BLAST