GenomeNet

>eol:Emtol_3511 D-alanine--D-alanine ligase domain protein; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MPCYFLNGTLLAEPNCEQNLIMTNKIRVGVFFGGQAREREISYLGGKTAFEHIDKAIFEP
VPIFVDSLGHFIQINPELLYEDSIRDFFPSKNLNRGFRVYIESLGELNETQLYKLIYKVG
KQVQPTDFSNLMDFAFVIMHGPQAEDGAIQGLLEWYGIPYMGPGLMGSAVGIDKPMQNKL
LSLVTGQKKKMVTFTRDEWQVADRSKLFTDLINNIGFPFVVKAPHQGSSIGVAIVRKRSL
EEFTKAIQQCFFETTFLKREWEKMTDRQKRHLMEKTSNLDEGIGFPLYVNGKILHHPAEL
MEELDALLFTLDSVTAISANAEDHVMIEEFVVGQEFSCGVIQHDDGTALALPPTEIYGEI
QTFDFKSKYKSNVTKKRIPVETSIENLNKIHDNLLKAFNNLGFSVVTRIDGFLTPDSRVL
LHDPNTLPGMSPASLIFKQMAEIGLTVTQSITYFVRQSIRERIRSGKNTVALRNLLEKID
SLIEGRVSAHRKKVAIIFGETDEEYKTAQRKLGEYASSVAYEPVCVCAARNGQMYKIPVN
LMFKADIQDFGQNIGKSKHPFIAEIIRKAEKITNKYAGSFDTQVKKLSETELAESVQFIF
QCDSDTLVEL

BLAST