GenomeNet

>epr:EPYR_00164 ppc; protein ppc (EC:4.1.1.31); K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MNEQYSAMRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGHDAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHTISPNGEGAKNPELLAKTFQRLKQQPALTEA
AVHEALGSLSLELVLTAHPTEITRRTLIHKLVEVNSCLKQLDHNDLSDYEHAQIMRRLRQ
LVAQAWHTDEIRKYRPSPVDEAKWGFAVVENSLWEGVPQFLRELNEQVEAAFGYTLPVDF
VPVQFTSWMGGDRDGNPNVTADITRHVMQLSRWKATDLFLRDIAVLISELSMSECTPEVR
ELCGNPEALEPYREIMKNLRSQLMSTQAYLAGRLKGERLARPADLLISNEQLWNPLYTCY
QSLQACGMGIIANGQLLDTLRRVKCFGVPLVRIDIRQESTRHTEAIAEITRYLGLGDFES
WSEADKQAFLIRELNSKRPLTPRQWEPSAETKEVLDTCRVAAEAPQGSIAAYVISMAKTP
SDVLTVHLLLKEAGIGYAMPVAPLFETLDDLNNANAVMSQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGITLTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTGAILEANLLPPPEPKTEWIGIMDRL
STVSCQMYRGYVREHADFVPYFRSATPEQELAKLPLGSRPAKRRPAGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQQAMADGHQDQLEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVDKSLWPLGKQLRDRLESDIKAVLTIANDAHLMADQPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEAAGGEPDARVEQALMVTIAGVAAGMRNTG

BLAST