GenomeNet

>erc:Ecym_1038 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hypothetical protein (A)
MSFDDLHKERRDKLDASVDEICKEFEVSKEKIHELTSYFIECMEKGLESDEKGEMYMGLP
MIPSYVMGKPNGTEEGVLIAADLGGTNFRVCSVELNGDHTFTIKQLKSAIPKELLEDDNV
SSDDLFGYLAKRTFAFMKKYHPESLINPCETLKLGFAFSYPVAQNSLSSGTLIRWTKGFS
IEDTVGKDVVKLYQQHLDALGLTQVRVVALANDTVGTFLSHCYSSKNASPLSTGELSDPV
IGCIFGTGTNGCYMEKIDNIKKLPEEFRKQMLAKGKTEMCINIEWGSFDNKLEHLPTTKY
DVLIDQQFTPNPGFHLFEKRVSGMFLGEVLRNVLVDLHARGLIFRQYSKDSLPHRVQKPF
NLSSEVMSHIEIDDSSDLRETELSLLQALRLPTTLEEREQIQKLVRAISRRSAYLAAVPL
AAVLIKTDALNKRYHGEVEIGCDGSVFEFYPGFRSMMRQGLALSPIGAEGERKVHLHVAK
DGSGVGAALCALVA

BLAST