GenomeNet

>erc:Ecym_1276 hypothetical protein; K00693 glycogen(starch) synthase [EC:2.4.1.11] (A)
MTRDIQNHLLFETATEVANKVGGIYSVLKSKAPVTCGQYKEHYHCIGPLNPDSVQIEVEQ
IDWEHGDGVWSMEMLPVKRTLQHMRERGVNFVYGRWLIEGAPKVILFDLESVRHHLSEWK
SDLWTTAGIPSPEDDMETNNAILLGYTVAWFLGELAAQDQRHAIVAHFHEWLAGVALPLC
RRRRIDVVTIFTTHATLLGRHLCAGNADFYNNLDSFDVDSEAGRRGIYHCYCIERAAAHT
ADVFTTVSQITAYESEHLLKRKPDGILPNGLNVIKFQTVHEFQNLHALKKERIHDFVRGH
FHWNYDFDLDNTLYFFVAGRYEYRNKGADMFIEALARLNYRLKAAGSKMTVVAFIIMPAK
NRSYTVEALRGQAVVKSLENTVKDVTTLIGKRLFEHAVRYPRSGKSEIPNELGELLKPSD
MVLLKKRVFALRRPEGSLPPIVTHNMVDDAADPILNQIRRVQLFNHSSDRVKIIFHPEFL
NANNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDLI
ERDQAKDYGIYIVDRRFKSPNESVEQLVDYMDEFCKKTRRQRINQRNRTERLSDLLDWKR
MGLEYVKARQLALRRAYPEEFMALVGEDLDDQDMDSLAGGQKFKVARPLSVPGSPRDRSS
SMSAILMTPGDLGTLQDANNANDYFHLSMQDEDENDEEDQN

BLAST