GenomeNet

>erc:Ecym_4307 hypothetical protein; K00814 alanine transaminase [EC:2.6.1.2] (A)
MMAILRSAATVENMLIKNSGLQATMDVLHGLPHATMGLRSISSGTSRIRFEPGDPLKLED
LNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSRE
VLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEY
LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVA
LPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIA
AKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGEC
GQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERS
SIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYC
TELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD

BLAST