GenomeNet

>erc:Ecym_7168 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (RefSeq) hypothetical protein (A)
MVKAGTNRAVAVLKGDAGISGIVHLEQGSEQEPAKISWEVSGFEPDSDHGFHIHEFGDNT
NGCTSAGPHFNPYKKTHGAPEDDARHVGDLGNIRADSNGVAKGSKMDHLVMLFGPTSVVG
RSVVVHAGKDDLGKGGNEESLKTGNAGARSACGVIGVAN

BLAST