GenomeNet

>esa:ESA_02622 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (GenBank) hypothetical protein (A)
MQNGAMKAWLDSSYLSGSNQSWIEQLYEDFLTDPDSVDAHWRSMFQQLPGTGAKPDQFHS
KTRDYFRRLAKDASRYSSSISDPDTNAKQVKVLQLINAYRFRGHQHANLDPLGLWQQERV
ADLDPAFHDLTEADFQETFNVGSFALGKETMKLGDLIEALKQTYCGSIGAEYMHITSTEE
KRWIQQRIESVAGHAGFSADEKKRFLSELTAAEGLERYLGAKFPGAKRFSLEGGDALIPM
LKEMIRHAGKSGTREVVLGMAHRGRLNVLINVLGKKPQDLFDEFAGKHKEHLGTGDVKYH
MGFSSDIETEGGLVHLALAFNPSHLEIVSPVVMGSVRARLDRLDEPSSNKVLPITIHGDA
AVAGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNPLDARSTPYCTDIGKMVMAP
IFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQPLMYQKIK
KHPTPRKIYADKLEQEGVAKLEDATEMVNLYRDALDAGECVVKEWRPMNMHSFTWSPYLN
HEWDESYPNKVEMKRLQELAKRISTVPDGIEMQSRVAKIYGDRQLMANGEKPFDWGGAET
LAYATLVDEGIPVRLSGEDSGRGTFFHRHAVVHNQANGSTWVPLQHIHNGQGQFKVWDSV
LSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLL
PHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLVVMSP
KSLLRHPLAVSSLEELANGAFLPAIGEVDELDPQGVKRVVLCSGKVYYDLLEQRRKNDQK
DVAIVRIEQLYPFPHHAVQEALKPFAHVHDFVWCQEEPLNQGAWYCSQHHLREVIPFGSA
LRYAGRPASASPAVGYMSVHQKQQQDLVNDALNVN

BLAST