GenomeNet

>esa:ESA_02926 hypothetical protein; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKEKFDVVLLGIDKQGQWHVNDASRYLLN
AEDPARIALHRSEKNVALIPGLSEQQLIESDNRQALPQLDVIFPIVHGTLGEDGSLQGML
RMANIPFVGSGVLGSAVSMDKDVAKRLLRDAGLAVAPFITLTRANRQRITFEDVKAQLGL
PLFVKPANQGSSVGVSKVNDEAQYHAAVALAFEFDHKVVVETGIKGREIECAVLGNDSPQ
ASTCGEIVVSSEFYSYDIKYIDDQAARVVVPADIAPDVNEKIRAIAIRAFQALECAGLAR
VDVFLTPDNEVIINEINTLPGFTNISMYPKLWQASGIGYQELITRLIELALERHQADAAL
KSSITG

BLAST