GenomeNet

>eta:ETA_04790 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] | (GenBank) bglA; BglA protein, 6-phospho-beta-glucosidase (involved in beta-glucoside utilization) (EC:3.2.1.86) (A)
MMSLPNDFLWGGAVAAHQVEGGWNQGGKGPSIVDVLSGGSHGVNRVITDGIDAQHQYPNH
LAVDFYHRYKEDIALFAEMGFKCFRTSIAWTRIFPQGDELEPNEAGLQFYDDLFDELLKY
NIEPVITLSHFEMPLHLVKEYGGWLNRKVVDFFVRYSEAVLKRYQHKVKYWMTFNEINNQ
RNWRYPLFGYCNSGVIFTDHEKPEQAMYQVLHHQFVASAQVVKLGHQINPNMKIGCMLAI
VPLYPWSCHPDDVMFAQEAMRERHLFGDVHLRGYYPSYIVKEWQRKGYQIEMQPGDEQTL
REGCADYLGFSYYMSNAVQYSEKDNSDGRHIEGFPGSRPNPHVKASDWGWQIDPVGLRYT
LNAFWERYQKPMFIVENGFGAYDKVEADGQINDDYRIAYLQAHIEQMKIAVLEDGVDLMG
YTPWGCIDCVSFTTGQYDKRYGFIHVNKNDDGNGDLARSKKKSFNWYKQVIASNGEDV

BLAST