GenomeNet

>etr:ETAE_1245 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) hypothetical protein (A)
MLIFAEHDRTANNGWRIPAITVTQGGALIAVSDARAVGTSDIGQNQDVHFGYRISYDRGD
TWGEIHDIAPSFNGKRQISDPAIVYNPDSGSTFLFGYYNDRFITSKPLSRVSDFFMFTSD
DGGKTWDRGTSLYDLAPTGYKYILQGPGSGMYHDGTLYLAAQAWHHDRDSSLVGSGATVT
SGYLYSSDNGVTWNSAWLRPDDKIVGAPGTGVDDLPDITSESSVFHHDGHIYLAAKSETS
RESKSRVVYRTKDNGQRWERVEEAFLPENISRAETSSLSLDDSVYLVGYSTATERANRDG
IYITTNTGRTIQVYDSPSYGYTSMTKDEDNLYILFEGEGDIYLQRYDIAARDYANISATI
LNRSNDLFDIATKLRTASSYIKGGYGSHASSDAEFVYADDWGKLGVFFARQSENSQRVPG
TIQYTNSDVSLTLAKDDILFSGDNVFVGYQHSDIQYDNDAANKVKSVLAGYSYQHDFGVL
SYHLMVNTIYGENRFSRNRREGLGRKADFNAYSVAIKNMLAKDIYLADGFYAGVASGLHS
TFFSHSAIQERGGNGWNNASVDSADHASNQLLLDGQLSKRLHIMQSNELTLTAKASYQYE
LMDTAKWAEAYRVLDARRLMPAPVKRYPHGLATGYLEAALSLHPQAVIAAGASLNTDGDG
LVAGSFTYTF

BLAST