GenomeNet

>etr:ETAE_2584 sucA; component of the 2-oxoglutarate dehydrogenase complex,thiamin-binding protein; K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MQNGTMKAWLDSSYLAGANQSYIEQLYEDYLTDPDSVEGSWKTLFQQLPVNGLPPDQLHS
QTREYFRRLAKDPTRFGLAFNDPQTDAKQVKVLQLINAFRFRGHQQANLDPLGLWKQESV
ADLDPAFHHLTPEDFNETFNVGSFAIGSDTLRLADLYRALQQTYCGTIGAEYMHLTNTDE
KRWLQQRLESVMGQPAFSPQEKRRFLQELTAAEGLERYLGAKFPGAKRFSLEGGDALIPM
LKELIRHAGRNGTREVVLGMAHRGRLNVLINVLGKCAGELFDEFAGKHKDHLGTGDVKYH
MGFSSDMETEGGPVHLALAFNPSHLEIVSPVVMGSVRARRDRLDRTRSDIVLPITIHGDA
AVAGQGIVQETLNMSQARGYEVGGTVRIVINNQIGFTTSNPLDARSTQYCTDIGKMVQAP
IFHVNADDPEAVAFVTQLALDFRNCFKRDVFIDLVCYRRHGHNEADEPSATQPVMYQKIK
KHPTPRKLYADRLTEQGVITLEDATEMVNLYRDALDGGGCVVAEWRPMTMHSVTWDPYLH
HEWDEPYPHAVAPQRLQDLARCISRVPEAVEMQARVAKIYADRAEMAEGKRPFDWGGAEN
LAYATLVDEGIPVRISGEDCGRGTFFHRHAVIHSQRDGAVYVPLENVHNGQGDFKVWDSV
LSEAAVLAFEYGYASAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRLCGLVMLL
PHGYEGQGPEHSSARLERYLQLCAQQNIQVCVPSTPAQVYHMLRRQALRAMRRPLVVMSP
KSLLRHPLAVSSLDELAQGCFQPAIGEIDPLDAQRVKRVVMCSGKVYYDLLEQRRKNGQD
NVAIVRIEQLYPFPHQAVQAVLAPYTQARDFVWCQEEPLNQGAWYCSQHNFREVIPFGAV
LRYAGRPASASPAVGYLSVHREQQQALVDDALNVE

BLAST