GenomeNet

>evi:Echvi_1909 transcriptional regulator/sugar kinase; K00886 polyphosphate glucokinase [EC:2.7.1.63] (A)
MKILVIDIGGSNIKILATGADERIKIPSGTNFSPEEMIPLVKKHASKWKYDHVSIGFPGI
VKNSDILTEPVNLGQGWETYDFEEAFGCPIKIVNDAAMQALGSYEGKKMLFMGLGTGLGT
AMVINNVVIPMEAAHLPYRKATFEAYLGKSYFFSKGPKKWEKHVHKAVEYFFRAFQPDEI
VLGGGNSKELKNIPDGCRLGSNKHAFKGGFRLWEEDFRV

BLAST