GenomeNet

>evi:Echvi_1909 K00886 polyphosphate glucokinase [EC:2.7.1.63] | (GenBank) transcriptional regulator/sugar kinase (A)
MKILVIDIGGSNIKILATGADERIKIPSGTNFSPEEMIPLVKKHASKWKYDHVSIGFPGI
VKNSDILTEPVNLGQGWETYDFEEAFGCPIKIVNDAAMQALGSYEGKKMLFMGLGTGLGT
AMVINNVVIPMEAAHLPYRKATFEAYLGKSYFFSKGPKKWEKHVHKAVEYFFRAFQPDEI
VLGGGNSKELKNIPDGCRLGSNKHAFKGGFRLWEEDFRV

BLAST