GenomeNet

>eyy:EGYY_01770 K01580 glutamate decarboxylase [EC:4.1.1.15] | (GenBank) hypothetical protein (A)
MEQSATSKVLDSMDEGTKYLTPIFGSESSDAQMPRLTMNDQPVEPRIAYEMIKEYLSIEG
NATQNLTTFCQTYMEPMATKIMAETLEKNAIDKDEYPMTADLENRCVAMIGDLWHANPDE
EPMGTSTVGSSEACMLGGLAMLFRWKKLAKDAGIDIYTAQRPNLVISAGYQVCWEKFCRY
WDIEMRLVPLEKDHLSLNMDTVMDYVDDHTIGITAILGITYTGKFDDVKKLDELVEAYNQ
EHTDLPIRIHVDGASGAMVAPFVNPDLEWDFRLKNVWSINTSGHKYGLVYPGIGWVVWRS
KEALPEDLIFWVSYLGGEQATMAINFSRSASQIVGQYYVLMRNGFEGFKEIQERTLDVAR
YLALELDEMGIFEIYEDASNIPIVCWGLKEDAGVEWSLYDLSDRLRMSGWLVPAYPMPAD
MQDTTVQRVVARADFSMQLAIKLVEDMKKEIDTLNKAKFVTGNTQGVIQTGFNHGGRAAV
NHGDKEQTKAPTPQK

BLAST