GenomeNet

>faa:HMPREF0389_00532 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) D-ala D-ala ligase N-terminal domain protein (A)
MVKQNIAILFGGKSEEHEVSCRSAKYIFENVDRDKYRPFLIGIDKLGNYYYMKECNIEHL
IDCTWTDFIETNEVCFSKGDERFTLQLQGEKIVFDVVFPALHGPNGEDGKLQGLMEFVNI
PYVGCNSISSAICMDKEITKRLVGIEGVRQVPYVILYEGVVAEEKLLEMEEIGYPLFVKP
ANMGSSVGVSKAENQQELLQAIRVASKYDDKVIVEKGIDALELEIAALGDGKDAYFSTVG
CIKPRDIFYDYDSKYLTNDADFYIPAPISFEKETELREMARKAYTAMLCEGLSRIDFFMD
KETQEIYFNEINTMPGFTAISLYPQLMDYDGVGAKELIGRLIDYAWRRYEKNK

BLAST