GenomeNet

>fbc:FB2170_06340 putative thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPMVDKRYHEEM
VVSHDANEIRSTPVPAAANIRILADTCDVIGIDEAQFFDDEIVTVCNDLANRGVRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKAHNDDLVLLGETGEYEP
LSRAAYYKAMLKERVKEIDVDVEEISKAKKDVNG

BLAST