GenomeNet

>fca:101080901 K18671 histone deacetylase 10 [EC:3.5.1.98] | (RefSeq) HDAC10; LOW QUALITY PROTEIN: histone deacetylase 10 (A)
MRTALVYHEDMTAARLLWEDPECEIERPERLTAALERLRQWGLEQRCLQLAAREASEAEL
GLVHSPEYVSLLRGTQTLSTRELQALSGQYDAVYFHPSTFHCARLAVGAALQLVDAVLTG
AVHNGLALVRPPGHHGQRAAANGFCVFNNVAIAAKYAKRRHGLHRILIVDWDVHHGQGIQ
YIFEDDPSVLYFSWHRYEHGHFWPYLRESDADAVGQGQGRGFTVNLPWNQVGMGNADYVA
AFLHVLLPVAFEFDPELVLISAGFDSAIGDPEGQMRATPECFSHLTQLLQVLAGGRVCAV
LEGGYHLESLSQSVCMVVKALLGDPALPLSGPMEPHHSALESIQSVRAAQAPHWKSLRQQ
GSTPILNPSTYSLERRASPVSPGGPKFKAAEAQASAALSSLLDQLHLNPTLPVRTAVSLT
ALDAALVLPADVLRQEGSAPQEETRAWARLHEALAQDKALTALGKVLHLLNGILDGQVSS
GIAATPEPAAAPTLDVVIRRSLSHGARRLLCVAVGQLDRPADLADDGRNLWLNIRGKEAA
APSMFQVSVPLPGTTGGFVSCVLALVLPLAYGFQPDLVLVALGPAHGLQAPQAALLASLL
RGPAGGRVLVLLEQGSTSQLAGILARVLQGEAPPGLGPFSMASPEDTQALIYLRGQLEAE
WKMLQVAAPQVP

BLAST