GenomeNet

>fca:101082315 K00031 isocitrate dehydrogenase [EC:1.1.1.42] | (RefSeq) IDH2; isocitrate dehydrogenase [NADP], mitochondrial isoform X1 (A)
MAGYLRVVRSLCRASGSGPAWAPAAPTGPNLQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVVDRAGTFKIVFSPKDGSGAKEWEVFNFPAGGVGMGMYNTDESISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVQTVESGAMTKDLAGCIH
GLSNVKLNEHFLNTSDFLDTIKNNLDKALGQ

BLAST