GenomeNet

>fca:101093313 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (RefSeq) LIG1; DNA ligase 1 isoform X1 (A)
MQRSIMSFFHPKKEGKAKKPEKETSSRETEPPPKVALKERNGEVPENDSPVKRPGRKAAR
VLGSEGEEEDEALTPSKGQKPAPGSPQVSPPSPVTFPEGSPPLSNTSPAGLSPTGIPKRR
TARKQLPKRPIQDILEEQSKDEDREAKRKKEEAETPTESLTEPELAQKEEAEGDRPTTPA
EHLETSPAEPPTDSTSEPEVAGKQETREGDQAKPPPRAPKTVSSFFAPRKPATKKEGKEE
GPGAPRKEEAKGPLDPSGYNPAKNNYHPVDDACWKPGQKVPYLAVARTFEKIEEVSARLR
MVETLSNLLRSVVALSPPDLLPILYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGRQLE
SVKAEAAEKGDVGLVAENSRSTQRLMLPPPALTAAGVFAKFRDIAGLAGSASTAKKMDVI
KGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQDFPPAVVDAGKGR
TAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLEHLPEHCRLSPGVPLKPMLAHP
TRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDIISRIPK
IKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAADIQVQVCLYAFDLIYLNG
ESLVREPLSRRRQLLRENFVQTEGEFVFATSLDTKDTDQIAEFLEQSVKDSCEGLMVKTL
DVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEES
EELQAICKLGTGFSDEELEDHFQSLQALVLPTPRSYVRADGAVAPDHWLDPSAVWEVKCA
DLSLSPIYPAARGLVDSEKGISLRFPRFIRVREDKKPEEATTSAQVASLYKKQSQIQNQQ
GADLDSDPEDFY

BLAST