GenomeNet

>fcf:FNFX1_0157 hypothetical protein (EC:6.3.2.4); K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKC
FVALHGEDGENGRVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLT
DKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYEEASKYGEVMIEQWVTGKEIT
VAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC
SGHARVDFIYDDRGNFYIMEINSSPGMTENSLSPKSAAAEGVDFDSFVKRIIEQAQ

BLAST